Amp vk: VMP — ВК Музыка

Содержание

Наши партнеры — AMP

Москва

Санкт-Петербург

Владимир
Волгоград
Грозный
Екатеринбург
Нижний Новгород
Новосибирск
Казань
Калининград
Краснодар
Киров
Йошкар-Ола
Омск
Иркутск

Самара
Саранск
Саратов
Севастополь
Пермь
Пятигорск
Челябинск
Таганрог
Тула
Ростов-на-Дону

Стать партнером

Ваше имя
Телефон
E-mail

Я согласен с правилами обработки персональных данных

Москва, Переведеновский переулок, д. 21, стр. 5

+7 926 5 259 259
+7 929 652 92 59

ultimatedm.ru

Москва, Волоколамское шоссе, д. 97

+7 495 722 29 09
+7 495 761 48 82

auto-hifi.ru

Москва, Волгоградский проспект, д.32, к.10

+7(495)940-98-00

https://caraudiostore.ru

[email protected]

Москва, Волгоградский проспект, д.32, к.10

+7(495)940-98-00

 

https://carhifistudio.ru

[email protected]

Москва, Архитектора Власова 6

 

+7 (495) 589-60-34

 

 

stylegarage.ru

Москва, ул. Беломорская 40
Санкт-Петербург, ул. Гранитная 51

+7 903 969 52 55
+7 495 979 78 05

elsheep-team.ru

Санкт-Петербург, ул. Маршала Казакова 35

+7 812 407 28 18

avtozvuk-spb.ru

Студия автозвука Legend Auto: г. Санкт-Петербург , ул. Ташкентская, 3 Б

+7 812 953-83-00

+7 921 097-27-85

 

Магазин Автозвука Studio Sound: Владимир, ул. Гастелло 8б

+7 910 122 43 65

Пространство звука SOLO: г. Волгоград, ул. Гагарина, д. 16

+7 927 514-44-44

[email protected]

Безопасность и Комфорт автомобиля
Казань, ул Фучика, д. 99А

+7 917 225 96 00

«Кто хочет, тот ищет возможности,

  кто не хочет — ищет причины»

Магазин «Эпицентр Звука»
Пятигорск, рынок «Казачий», магазин 308

+7 918 777 88 77

Сеть магазинов автомобильной электроники «VEGA»: Пермь, ул. Куйбышева, д. 98

+7 342 244-04-04

www.vega-sound.ru/
vk.com/vega_perm

Сеть магазинов автомобильной электроники «VEGA»: Йошкар-Ола, пр. Гагарина, д. 13

+7 8362 45-35-25

www.vega-sound.ru/
vk.com/vega_perm

Интернет магазин автоэлектроники «СТАЛ»
Самара, ул. Партизанская, д.15

+7 846 265 10 10

stal63. ru

Установочный центр «Akulov Sound»
Краснодар, ул. Коммунаров, д.268 г строение 27

www.akulosound.ru
Instagram: akulov.sound

+7(918)677-49-29,
+7(918)31-777-55

г. Краснодар, ул. Российская, 52/1

+7 861 257-73-73

Саратов, ул. Чернышевского, д. 54/4

+7 845 2 206 202

[email protected]

Севастополь, ул. Камышовое шоссе 40

+7 (978) 818-96-66

pro12v.com

Лаборатория качественного автозвука «Акцент»: г. Иркутск, ул. Тургенева, 18

+7 (924) 6-397-387

WhatsApp:+7(964)2-626-262

Telegram:+7(902)7-692-988

[email protected]

@lab_accent_irk

г. Екатеринбург, пр-кт Космонавтов 11Е

тел.  (343) 200-60-50

https://vk.com/veteraudio

veteraudio.com

г. Екатеринбург, ул. Шаумяна, 35

тел. (343) 200-66-55

https://vk.com/veteraudio

veteraudio.com

Магазин Автозвука Studio Sound 52: 

Нижний Новгород, ул. Суздальская 70, павильон А44

тел. +7 950 348 83 45

Магазин Автозвука SibZvuk:

г. Новосибирск, ул. Фрунзе 142\1 (левый вход, 2 этаж)

тел. +7 (383) 375-43-83
+7 (923) 775-43-83

https://sibzvuk.ru/
[email protected]

г.Саранск, Лямбирское шоссе, 2 КМ (ТЦ «2 КМ»)

+7 8342 34-34-04

avtobutik13.ru
vk.com/avtobutik13

Калининград, Дзержинского, 19

+7 906 239 9339

www.ehostayl.ru
vk.com/ehostayl

Офис, оптовые продажи: Челябинск, ул. Каслинская, 64 (Торговый центр, офис №1)

8 (351) 264-65-11

uralautosound.ru
[email protected]

Магазин: Челябинск, проспект Победы, 154

8 (351) 777-22-22

uralautosound.

ru
[email protected]

Торгово-установочный центр «Car-Audio»: Челябинск, ул. 8 марта, 56

8 (351) 326-08-66
8 (351) 359-31-59
8 (351) 328-12-38

caraudiomiass.ru
[email protected]

Cтудия Фаворит: Грозный, бульвар Султана Дудуева, 6а АЗС Лидер.

8 (928) 946-02-00

 

Cтудия Фаворит: Грозный, ул Н Назарбаева 41

8 (928) 088-88-01

Омск, ул. Декабристов, дом 91, СКК Им. В. Блинова, бутик 109

8-913-633-55-25
8 (3812) 335-525

Перейти в магазин

 

«CarAudioCenter»: г. Таганрог, ул. Котлостроительная, 20

 +7 (928) 126-57-00

caraudiocenter.ru

@caraudiocenter.ru

vk.com/car_audio_center

 

Автозвук от чемпионов « Карцентр.рф»: Тула, ул. Епифанская, 58а

 +7 950 911 9444

карцентр. рф
vk.com/carcenter

DИНАМИК Тюнинг-Автозвук: Ростов-на-Дону, ул. Красноармейская, 180А

+7 863 299 9808

www.audio-tuning.ru

Сеть магазинов автомобильной электроники «VEGA»: Киров, ул.К.Маркса, д.140

 +7 8332 37-50-90

www.vega-sound.ru/
vk.com/vegasound_kirov

Сеть магазинов автомобильной электроники «VEGA»: Киров, Хлебозаводской пр-д, д. 9

 +7 8332 21-43-43

www.vega-sound.ru/
vk.com/vegasound_kirov

Мессенджеры (Facebook, VK, WhatsApp, Telegram, Viber, Кнопка чата)

Содержание

  • Описание функционала
  • Расположение
  • Настройка мессенджеров
    • Настройки
      • WhatsApp
      • Facebook
      • Telegram
      • VK
      • Viber
      • Открыть чат
    • Внешний вид
    • Условия
  • Сочетание нескольких мессенджеров
  • Отчетность

Описание функционала

Отображение виджетов мессенджеров на вашем сайте позволит клиентам выбирать самый удобный способ для связи. Показывайте один из нескольких виджетов или комбинируйте их с помощью Мультикнопки.

Расположение

Подключение мессенджеров происходит в меню «Продукты — Мессенджеры».

 

В открывшемся окне вы сможете посмотреть уже созданные виджеты мессенджеров, их активность, редактировать их или создать новый:

 

По нажатию на кнопку «Добавить виджет» вам станут доступны на выбор следующие виджеты:


Клик по любому из них откроет окно настройки виджета.

 

Настройка мессенджеров


Настройки

В начале экрана вы увидите поле названия виджета — вы можете указать любое, удобное вам. Именно под этим названием виджет будет доступен в списке созданных виджетов. 

Следом идет настройка страницы, с которой будет инициироваться диалог или выбор чата. Подробнее о настройке с каждым мессенджером ниже:

WhatsApp

 

WA. me: Прямая связь — функция в WhatsApp, которая позволяет начать чат с человеком, номер которого не сохранен в адресной книге вашего телефона, с помощью ссылки вида https://wa.me/<номер> или https://wa.me/message/<id аккаунта>. Функция «Прямая связь» работает на телефоне и в WhatsApp Web.

Введите номер телефона, либо установите чекбокс «Бизнес-аккаунт» для ввода адреса вашего бизнес-аккаунта. В процессе ввода будет отображаться сформированная ссылка, при переходе по которой произойдет переадресация в чат.

При активации «текстовое сообщение», появится окно для ввода текста.

У Вас есть 2 возможности:

1. Вы можете указать  информационное сообщение для клиента. 
Данный текст появится в сообщении у клиента и он сможет набирать свое сообщение после этого текста или же в другом сообщении.
В личном кабинете зафиксируется только клик.

2.  Если же вам необходимо, чтобы в личном кабинете Calltouch создавались заявки с данными клиента, необходимо подключить платный сервис wazzap24.

Обратитесь к личному менеджеру или в техническую поддержку [email protected] предоставив доступ от wazzap24.

Необходимо будет составить текст так, что бы клиент не удалил его, а отправил. И всегда быть готовым к тому, что пользователь может его удалить.

По умолчанию поле имеет значение: «Сообщение отправлено с сайта {site}». Вы можете его редактировать и добавить динамические параметры {site}, {sessionId} или {ctClientId} в текст для передачи сессии пользователя (это необходимо для дальнейшей склейки лидов из CRM c параметрами Calltouch).

Например:

«Заявка №{sessionId} с сайта {site}. Просьба не удалять данную строку, она необходимо для быстрого поиска вашего обращения»

Как это работает:

Клик клиента на виджет WhatsApp откроет диалог в WhatsApp с текстом. После его отправки в личном кабинете Calltouch  будет зафиксирована заявка с источником и контактными данными клиента (номер телефона, ФИО-если указана данная информация в WhatsApp), а в WhatsApp будет передана информация о сессии.

Facebook

M.me — это сервис коротких URL от Facebook, который перенаправляет пользователей на человека, страницу или бот в Messenger. Ссылка имеет формат http://m.me/<PAGE_NAME>, где PAGE_NAME — это идентификатор страницы Facebook, к которой привязан Messenger. Например, http://m.me/Calltouch.
Введите адрес страницы в соответствующее поле для формирования ссылки, при переходе по которой произойдет переадресация в чат.  Клик клиента на виджет Facebook откроет диалог в Facebook Messenger с введенным идентификатором страницы.

Facebook в России признан экстремистской организацией.

 

Telegram

Используя возможности Telegram, вы можете размещать прямую ссылку для переадресации в чат Telegram. Эта ссылка имеет вид tg://resolve?domain=username, например tg://resolve?domain=blogcalltouch.

Введите логин пользователя Telegram (username) в соответствующее поле для формирования ссылки, при переходе по которой произойдет переадресация в чат. Клик клиента на виджет Telegram откроет диалог в мессенджере с введенным логином пользователя.

VK

Используя возможности VK, вы можете размещать прямую ссылку для связи с группой ВКонтакте. Эта ссылка имеет вид https://vk.me/<адрес страницы>, например https://vk.me/calltouch. Введите адрес страницы для формирования ссылки, при переходе по которой произойдет переадресация в чат.

В конце окна настроек вы можете найти график показа виджета. Вы можете выбрать часовой пояс и время и дату показа виджета. Виджет будет показываться только в то время, которое отмечено знаком плюса. На скриншоте ниже виджет будет показываться круглосуточно, так как выбраны все часы и все дни недели:

Viber

Вы можете использовать ссылку для переадресации в Viber, она может быть двух видов — для переадресации в чат с человеком, номер которого не сохранен в адресной книге вашего телефона, и в чат публичного аккаунта компании.

Для переадресации в личный чат используйте номер телефона абонента 79001231122, без скобок и тире.

Для переадресации в публичный аккаунт компании используйте URI бота Viber.

Открыть чат

Данный тип виджета используется для того, чтобы объединить используемый вами чат и остальные виджеты Calltouch в функционал Мультикнопки.

При клике на иконку чата в мультикнопке будет открываться окно выбранного чата.
Для корректной работы открытия чата через мультикнопку в настройках используемого чата необходимо изменить видимость кнопки чата и выбрать вариант «скрытый».
Это позволит скрыть оригинальную кнопку чата и само окно и открывать его только через клик по мультикнопке.
Обратите внимание, если чат отключен или скрипт чата удален, при клике на иконку в мультикнопке пользователь увидит ошибку.

В настройках у вас есть возможность выбрать чат из выпадающего списка:

  • Чат carrot quest
  • Чат Chatra
  • Чат Jivosite
  • Открытие произвольного чата


Обратите внимание! Для настройки открытия произвольного чата необходимо добавить в код вашего сайта функцию открытия вашего чата в рамках функции  _calltouchChatClick. 

Функция может быть вызвана так:

    window._calltouchChatClick = function(){
/*функция открытия вашего чата*/ }

По клику на кнопку произвольного чата будет выполняться содержимое функции.

Внешний вид

Таб «Кнопка». В настройках кнопки вы можете выбрать расположение виджета на десктопе и мобильных версиях сайта, изменить радиус скругления кнопки и размер иконки, настроить анимацию. 

Обратите внимание! Эти настройки влияют только на показ только этого виджета на одной странице. Если вы планируете показывать на странице несколько разных мессенджеров одновременно, используйте Мультикнопку.

Подробнее о настройке кнопки: Стандартная кнопка 

Условия

На этом табе вы можете задать показ виджета определенному трафику, типам устройств или показ на определенных страницах, а также по достижению целей. Подробнее о настройках условий показа читайте в нашей статье.

 

Сочетание нескольких мессенджеров

С помощью Мультикнопки вы сможете показывать пользователям сразу несколько виджетов мессенджеров (и не только их) на одной странице.

Мобильная версия:

 

Десктоп версия:

О настройке Мультикнопки читайте в отдельной статье.

 

Отчетность

Статистика по мессенджерам находится в разделе Эффективность виджетов.

Так как у данного типа виджетов есть только показы кнопки и клики, для отображения данных необходимо добавить нужную метрику — «Клики»:


VK Play против СНГ-игроков. «Поддержите отечественного производителя. В смысле нет? Мы не спрашивали» / Компьютерные и мобильные игры / iXBT Live

Ох уж эта игровая индустрия последних лет. Вместо ожидания игры приходится считать переносы и ожидать подвоха. Не получается, как раньше, просто ждать игру, предвкушая эпичное приключение.

Но, как ни странно, от Atomic Heart подлянки я не ожидал. А зря. Ведь теперь самая ожидаемая мной игра стала эксклюзивом VK Play. И это плохо как для разработчиков, так и для игроков. Предвкушая комментарии о «диванном аналитике», сразу поясню: да, я такой. Поэтому далее вы увидите критику, предположения и оценку действий именно от диванного аналитика. Что в переводе с токсичного — мнение простого игрока.

На Atomic Heart в последнее время сосредоточено очень много внимания. Что, конечно, не удивительно после столь эпичных трейлеров. Особенно последних под песни «Музыка нас связала» и Звёздное лето». Альтернативный и уникальный взгляд на Советский Союз, шикарная графика, геймплей как минимум уровня BioShock и всё это от наших разработчиков. Понятное дело, что конечная оценка продукта будет после релиза. Но, как по мне, уже сейчас можно смело заявить, что это не очередные «убийцы» западных игр. А талантливая студия со своей интересной идеей. Главное, с такими амбициями не ударить в грязь лицом. Ведь чем больше ты привлекаешь внимания игроков, тем сильнее тебе прилетит за неоправданные ожидания.

И вот, как говорится, когда ничто не предвещало беды. В интернете стали одна за одной появляться новости касательно доступности Atomic Heart в странах СНГ и России. Каково же было моё удивление, когда в конечном итоге оказалось, что игра для этих стран теперь будет эксклюзивом VK Play. А ру страницу в Steam для игры уберут. Это же надо додуматься сделать эксклюзивность в рамках одной платформы! Да, Тим Суини. После такого откровения захотелось найти виновников «торжества», и как минимум, выразить своё негодование. Благо, искать VK Play оказалось не сложно. И зайдя в комментарии под последней новостью «Atomic Heart стала эксклюзивом площадки VK Play» я увидел…

Огромное количество подогретых булочек, сидящих на стульях и гневно поливающих VK Play бранью. На что VKP даёт максимально приторный ответ:

Основная наша цель — предоставить комфортный пользовательский опыт, а также открыть новую страницу истории, обеспечив запуск Atomic Heart в России и СНГ на таком уровне, которого эта сюжетная игра по-настоящему заслуживает. Это позволит миллионам игроков поддержать разработчиков, а также не придется переплачивать посредникам, заниматься конвертированием валют или регистрацией других систем оплат.

Белые и пушистые VKP хотят как лучше. И вообще, наверное, не платили за эксклюзивность. Хотя, возможно, по поводу последнего так и есть. Но зачем отбирать у игроков выбор? Неужели мы не в состоянии сами решить, где нам купить игру? В состоянии, конечно. Вот только VK play на это плевать. Они стараются давить на патриотизм, мол, нужно поддерживать отечественного производителя. Который, к слову, никогда не поддерживал своего потребителя, монетизируя всё и вся. Мало того, они заявляют, что таким образом разработчик получит больше денег с продажи копии игры, чем в Steam. Нет, они точно по методичкам Суини работают.

Жаль только они не знают, что политика эксклюзивности давно ненавистна PC игрокам. А уж тем более в рамках одной платформы. Я, конечно, понимаю, что в этом году Epic Games для России стал спасательным кругом и возможностью покупать игры без переплат. Но это всё ещё не отменяет того факта, что компании, продавшие эксклюзивность своих крупных проектов в Epic Games, сильно не добирают в плане продаж. Как не крути, а Steam уже не раз доказал свою незыблемость. Даже через пень колоду игроки всё равно пополняют кошелёк Steam и покупают там игры. И это несмотря на комиссию при пополнении. Для меня Steam гораздо удобнее прочих лаунчеров, и я хочу и буду играть через него.

Важно отметить, что даже Sony в рамках конкурентной борьбы с  Xbox практически отошли от политики эксклюзивности. И это они ещё не пробовали запускать свои проекты на старте на PC. Сразу бы поняли, какую прибыль они теряли всё это время. А VK Play, вместо того, что бы учится на чужих ошибках, решили поковырять ножиком в старой ране. И теперь заслуженно отхватывают за это.

VK Play позиционирует себя как отечественную площадку для игр и просит поддержать их в это непростое время. И, возможно, в другой ситуации можно было бы обратить на такие душещипательные слова внимание, но только не тогда, когда тебе указывают. Нельзя хотеть быть поближе к народу и одновременно плевать на него. Плюс ещё неизвестно, какую цену отечественный производитель запросит за свой продукт. Но, к счастью для VKP, среди игроков есть и те, кто готов их поддержать и отнёсся к данной новости положительно. Поэтому, возможно, они таки смогут продать пару тысяч копий. Остальные же найдут способ купить в Steam или вовсе спиратят.

Другое моё негодование новым отечественным сервисом заключается в том, почему именно этот путь они выбрали. Я, конечно, многого не понимаю, но хочется спросить у «наших» VK. А нельзя ли было вместо создания своей площадки начать как-то сотрудничать со Steam. Стать издателем например, договориться о способах оплаты. Уверен такие потуги народ бы принял куда теплее. Вы же стараетесь для игроков? Или всё таки для себя? Ответа я, конечно, не дождусь, и возможно, всё это слишком сложно для них. Но хотя бы попытаться сделать что-то в этом направлении они могли? Могли. Но не стали. По крайней мере, я таких новостей не нашёл.

Что же получается в итоге? Студия разработчик Mundfish пока хранит молчание. Как уже писал выше, платили ли им VK Play или это их решение, наверняка мы узнаем не скоро. Пройдясь по разным форумам и пабликам, я понял, что данную новость большинство восприняло негативно. То есть акция от VK Play «мы для игроков» провалилась. Остаётся ожидать дальнейших подробностей и разрешения ситуации. Возможно, но очень мало вероятно, Mundfish или VK дадут заднюю и все мы выдохнем спокойно. Но, скорее всего, с приходом зимы кто-то отправиться искать своё сокровище под пиратским флагом, а кто-то понесёт дань отечественному производителю. Ведь в отличии от Steam, «не желающего наших денег» они наши деньги не просто хотят, а требуют.

Новости

Публикации

Atvel выпускает полную линейку помощников для дома. Недавно я делал обзоры на робота Atvel R80, мойщика окон Zorro Z5, моющий пылесос Atvel F16, а сегодня расскажу о фирменной вертикалке Atvel G9….

Хотите оживить свой старый винчестер и использовать его, как портативный жесткий диск для быстрого извлечения информации в любом месте и на любом устройстве? Тогда достаточно приодеть его в. ..

Эти удлинители с оранжевым проводом продаются во многих известных сетях магазинов. Они выпускаются с длиной от 10 до 50 метров на катушке, на рамке или просто мотком. Почему-то в одних магазинах…

Я являюсь активным покупателем на интернет площадках Aliexpress, Ozon и Wildberries. И перед покупкой анализирую возможность выбора товара именно в Ozon и Wildberries, так как в редких исключениях…

Практически в каждом многоэтажном доме сейчас установлен домофон. Такой «помощник» открывается с помощью специального домофонного ключа и является хорошей защитой для жильцов дома. Интересно, а…

Не секрет, что Bluetooth колонки пользуются особой популярность, как портативные колонки с хорошим звучанием и в защищенном корпусе — наиболее востребованы. Одна из лучших представителей подобных…

АМПЕР | Сделано вручную в Австралии — VK-AMPS

VK-AMPS | Сделано вручную в Австралии — VK-AMPS
  • [email protected]
  • AUDNZDUSDEURGBPCADAFNALLDZDAOAARSAMDAWGAZNBSDBHDBDTBBDBYRBZDBMDBTNBOBBAMBWPBRLBNDBGNBIFKHRCVEKYDXAFXPFCLPCNYCOPKMFCDFCRCHRKCUCCUPCZKDKKDJFDOPXCDEGPERNETBFKPFJDGMDGELGHSGIPGTQGNFGYDHTGHNLHKDHUFISKINRIDRIRRIQDILSJMDJPYJEPJODKZTKESKWDKGSLAKLVLLBPLSLLRDLYDLTLMOPMKDMGAMWKMYRMVRMROMURMXNMDLMNTMADMZNMMKNADNPRANGTWDNIONGNKPWNOKOMRPKRPABPGKPYGPENPHPPLNQARRONRUBRWFSHPSVCWSTSARRSDSCRSLLSGDSBDSOSZARKRWLKRSDGSRDSZLSEKCHFSYPSTDTJSTZSTHBTOPTTDTNDTRYTMTUGXUAHAEDUYUUZSVUVVEFVNDXOFYERZMWZWD
  • ДОМ
  • Комплекты ВЧ-усилителей
  • промышленный
  • Фотографии сборки
  • Документы
  • Свяжитесь с нами
  • Авторизоваться
  • Зарегистрироваться

Комплект усилителя HF/6 LDMOS мощностью 1 кВт Линейный усилитель HF LDMOS 1200 Вт 50 В Линейный усилитель LDMOS мощностью 1000 Вт, 50 В, 1,8–60 МГц, 4 x MRF300, поддон

Комплекты ВЧ-усилителей

< >

  • БЫСТРЫЙ ПРОСМОТР -55 дБ RF Sampler 2 кВт 1,8–80 МГц SO-239Конне… $124,00
  • БЫСТРЫЙ ПРОСМОТР 2KW AD8307 Power-SWR Направленный ответвитель 1,8-54 МГц 120,00 долларов США
  • БЫСТРЫЙ ПРОСМОТР Усилитель LDMOS 2KW TX-RX Relay с дискретизацией -55 дБ… $99.00
  • БЫСТРЫЙ ПРОСМОТР Гибридный разветвитель/объединитель от 1,8 до 60 МГц мощностью 2,5 кВт от $79. 00
  • БЫСТРЫЙ ПРОСМОТР 2KW 1,8–54 МГц Направленный ответвитель SWR Bridge $180.00
  • БЫСТРЫЙ ПРОСМОТР 1000 Вт LDMOS линейный усилитель 50 В 1,8-60 МГц 4 x MR… от $200.00
  • БЫСТРЫЙ ПРОСМОТР 50A 2-ступенчатая цепь фильтра помех линии постоянного тока $99.00
  • БЫСТРЫЙ ПРОСМОТР Eltek Flatpack2 Блок питания 42-58В от $140. 00
  • БЫСТРЫЙ ПРОСМОТР Icom Voltage 8-полосный автоматический декодер 79,99 долларов США
  • БЫСТРЫЙ ПРОСМОТР Цепь одноступенчатого фильтра помех линии постоянного тока 50 А $79.00
  • БЫСТРЫЙ ПРОСМОТР Усилитель драйвера класса А 1 — 150 МГц, усиление 30 дБ BFQ790 49,00 долларов США

АМПЕР | Сделано вручную в Австралии — VK-AMPS

VK-AMPS | Сделано вручную в Австралии — VK-AMPS
  • [email protected] com
  • AUDNZDUSDEURGBPCADAFNALLDZDAOAARSAMDAWGAZNBSDBHDBDTBBDBYRBZDBMDBTNBOBBAMBWPBRLBNDBGNBIFKHRCVEKYDXAFXPFCLPCNYCOPKMFCDFCRCHRKCUCCUPCZKDKKDJFDOPXCDEGPERNETBFKPFJDGMDGELGHSGIPGTQGNFGYDHTGHNLHKDHUFISKINRIDRIRRIQDILSJMDJPYJEPJODKZTKESKWDKGSLAKLVLLBPLSLLRDLYDLTLMOPMKDMGAMWKMYRMVRMROMURMXNMDLMNTMADMZNMMKNADNPRANGTWDNIONGNKPWNOKOMRPKRPABPGKPYGPENPHPPLNQARRONRUBRWFSHPSVCWSTSARRSDSCRSLLSGDSBDSOSZARKRWLKRSDGSRDSZLSEKCHFSYPSTDTJSTZSTHBTOPTTDTNDTRYTMTUGXUAHAEDUYUUZSVUVVEFVNDXOFYERZMWZWD
  • ДОМ
  • Комплекты ВЧ-усилителей
  • промышленный
  • Фотографии сборки
  • Документы
  • Свяжитесь с нами
  • Авторизоваться
  • Зарегистрироваться

Комплект усилителя HF/6 LDMOS мощностью 1 кВт Линейный усилитель HF LDMOS 1200 Вт 50 В Линейный усилитель LDMOS 1000 Вт 50 В 1,8–60 МГц 4 x MRF300 Поддон

Комплекты ВЧ усилителей

< >

  • БЫСТРЫЙ ПРОСМОТР -55 дБ RF Sampler 2KW 1.8Mhz — 80Mhz SO-239 Conne… $124,00
  • БЫСТРЫЙ ПРОСМОТР 2KW AD8307 Power-SWR Направленный ответвитель 1,8-54 МГц 120,00 долларов США
  • БЫСТРЫЙ ПРОСМОТР Усилитель LDMOS 2KW TX-RX Relay с дискретизацией -55 дБ… $99.00
  • БЫСТРЫЙ ПРОСМОТР Гибридный разветвитель/объединитель от 1,8 до 60 МГц мощностью 2,5 кВт от $79. 00
  • БЫСТРЫЙ ПРОСМОТР 2KW 1,8–54 МГц Направленный ответвитель SWR Bridge $180.00
  • БЫСТРЫЙ ПРОСМОТР 1000 Вт LDMOS линейный усилитель 50 В 1,8-60 МГц 4 x MR… от $200.00
  • БЫСТРЫЙ ПРОСМОТР 50A 2-ступенчатая цепь фильтра помех линии постоянного тока $99.00
  • БЫСТРЫЙ ПРОСМОТР Eltek Flatpack2 Блок питания 42-58В от $140. 00
  • БЫСТРЫЙ ПРОСМОТР Icom Voltage 8-полосный автоматический декодер 79,99 долларов США
  • БЫСТРЫЙ ПРОСМОТР Цепь одноступенчатого фильтра помех линии постоянного тока 50 А $79.00
  • БЫСТРЫЙ ПРОСМОТР Усилитель драйвера класса А 1 — 150 МГц, усиление 30 дБ BFQ790 49,00 долларов США

БАТ — Ламповый усилитель мощности ВК-90т

Оборудование усиление Усилитель мощности

Цена В настоящее время $14 995,00

Вопросы и ответы

Доступность: На складе

Этот товар есть на складе и готов к отправке. В зависимости от времени суток, когда вы размещаете заказ, он будет отправлен в тот же день или на следующий рабочий день.

Артикул:
АБАТВК90ТБ

БЕСПЛАТНАЯ ДОСТАВКА При заказе на сумму более 49 долларов США*

60 дней Гарантия удовлетворения*

Клиенты из Калифорнии : Щелкните здесь, чтобы
получить предупреждение о Предложении 65.

Цена В настоящее время $14,995.00

В наличии:

Электронная почта Требуется

Имя Требуется

Фамилия Требуется

Присылайте мне рекламные сообщения по электронной почте, в том числе о специальных распродажах, информацию о новых выпусках и многое другое. Music Direct не будет передавать вашу личную информацию третьим лицам.

Клиенты также просмотрели

  • Обзор
  • Характеристики
  • Отзывы (0)
  • Вопросы и ответы (0)

Описание

Усилитель мощности Balanced Audio Technology VK-90t оснащен схемой защиты без плавких предохранителей, активными источниками тока для двух каскадов усиления, интеллектуальной схемой автоматического смещения со светодиодными индикаторами и сильноточным полностью триодным нулем. -обратная связь, полностью сбалансированная топология. Его промышленный дизайн, посвященный 25-летию, дополняется новыми масляными конденсаторами серебристо-золотого цвета и сверхпрозрачной внутренней проводкой на пути прохождения сигнала. С ВК-90t, BAT осознает, что серьезным слушателям нужны уникальные технологии, удобный для пользователя опыт и точное звучание в высококачественном оборудовании. Эквивалент двух несимметричных усилителей на канал, VK-90t отвечает этим и многим другим требованиям и звучит завораживающе через несколько минут после включения. ВК-90т также означает, что нет ламп для смещения; нет предохранителей для замены; отсутствие пентодов, имитирующих триоды; и отсутствие постоянного тока на ламповом выходном каскаде. VK-90t — это звук будущего и музыкальная правда.

Активные двухкаскадные источники тока для улучшенной линейности и точности

ВК-90т расширяет преимущества активных источников тока, включая их как в первый, так и во второй каскад усиления схемы. Внедрение активных источников тока (как полупроводниковых, так и ламповых) для первых двух ступеней имеет множество преимуществ. В частности, улучшается линейность каскадов усиления; регулировки для первого и второго каскадов усиления становятся независимыми и их легче оптимизировать; а активные компоненты источника работают при более низком уровне нагрузки, что повышает надежность. Конечным результатом является впечатляющее улучшение линейности, обеспечивающее более точное представление выходного сигнала по сравнению с исходным входным сигналом. И это, по сути, мера любого усилителя.

Полностью симметричная, полностью триодная схема устраняет традиционные недостатки

В мире шаблонных конструкций пентодов/тетродов и хрупких несимметричных аналогов VK-90t стоит особняком. Его дизайн полностью симметричен от начала до конца. Вы можете думать об этом как о двух несимметричных усилителях на канал, с суммированием их сигналов на выходном трансформаторе. Поскольку через выходной трансформатор не протекает постоянный ток, последний имеет по-настоящему широкополосную конструкцию, которая также снижает низкочастотные искажения. При объединении ВК-9Полностью симметричная схема 0t с его сильноточной, полностью триодной, нулевой обратной связью, полностью сбалансированной топологией избавляет от всех недостатков двухтактных и несимметричных усилителей.

Конструкция шасси: алюминий
Конфигурация: стерео или моноблок на заводе
Выход на канал при 8 Ом/4 Ом (<3% THD): 75 Вт стерео / 150 Вт моно
Частотная характеристика: от 7 Гц до 200 кГц
Вход Полное сопротивление (каждая фаза): Стерео 200 кОм / Моно 100 кОм
Входная чувствительность: 1 В
Запас энергии: 600 Дж
Усиление: 26 дБ
Потребляемая мощность: 500 ВА (холостой ход): 1000 ВА (полная мощность)
Комплект ламп: 4 x 6C33C-B, 6 x 6SN7, 2 x 6х40
Размеры: 17″ x 8″ x 24 дюйма
Вес: 88 фунтов

Покупатели также купили

Интегральный усилитель BAT VK-80i | Hi-Fi News

Руководствуясь теорией и практикой дорогостоящей серии REX, традиционные выходные пентоды узурпированы парой мощных триодов в полностью сбалансированном ламповом интегральном усилителе BAT

Существует определенная внеклассная деятельность, которую можно проводить с использованием лампового усилителя. Как и в случае с их собратьями-стойкими приверженцами Hi-Fi — проигрывателями, ламповые усилители предоставляют возможности для настройки, настройки и обслуживания, и для некоторых это часть привлекательности. Тем не менее, новый интегрированный VK-80i от Balanced Audio Technology стоимостью 9995 фунтов стерлингов предназначен для использования по принципу «включай и работай» и обеспечивает взаимодействие с пользователем, больше соответствующее собственным полупроводниковым моделям, чем некоторые современники с горячими бутылками. Все острые ощущения лампового звука без суеты? Где подписать?

VK-80i также должен воспроизводить «звук» чистого триодного усилителя без одышки малой мощности. Таким образом, вместо классических триодов 300B квартет здесь представляет собой «фирменные» лампы 6C33C-B, которые также используются в референсном усилителе мощности REX 3, установленные в двухтактной конфигурации.

Эта компания из Делавэра, которая уже 25 лет занимается производством полностью сбалансированных усилителей, оценивает VK-80i в 55 Вт/8 Ом, хотя и с искажениями 3% THD на полном газу. В отличие от этого, REX 3 с более высокими характеристиками обещает 2×80 Вт или 160 Вт в мостовом монорежиме. Конечно, этот лучший усилитель также стоит 20 000 фунтов стерлингов и не обеспечивает функции оптимизации системы, как его интегрированный родственник.

Один симметричный (XLR) и три несимметричных (RCA) входа соединены рядами 4-мм разъемов для динамиков, настроенных на «Высокое», «Среднее» и «Низкое» сопротивление динамиков

Отколоть блок
VK-80i не имеет такого мускулистого внешнего вида, как REX 3, поскольку его глубина составляет «всего» 41 см, а не 60 см, и он менее чем в два раза тяжелее, но во многом похож на его дизайн. Основное шасси усилителя приятно тонкое, и ему удается провернуть трюк, делая его более удобным для размещения, чем он есть на самом деле. С установленными выходными триодами и четырьмя 6SN7, используемыми в линейном каскаде/каскаде предусилителя, высота приближается к 20 см.

За рядом 6C33C-B расположены два круглых трансформаторных модуля, которые придают блеск элегантному внешнему виду усилителя. А без защитной оболочки для трубок с подогревом (потребляемая мощность в режиме ожидания составляет 470 Вт) вы захотите, чтобы дети и домашние животные держались подальше. Этот усилитель очень похож на внешний вид, но не трогать, и он требует передышки.

Установка ламп — это простой процесс, как и настройка громкоговорителей и источников — для последних выберите один балансный XLR-вход VK-80i или три небалансных RCA-входа. Одна проблема, однако, заключается в необычной конфигурации контактов усилителя для крепления динамиков — есть два набора с маркировкой, обозначающей, что их следует использовать с условно «высоким», «средним» и «низким» сопротивлением динамиков.

Интеллектуальный дизайн
Поскольку наличие нескольких выходов для динамиков не означает, что устройство работает по принципу plug-and-play, у VK-80i есть две функции, которые подчеркивают его уступчивость. Во-первых, это «интеллектуальная схема автоматического смещения», которая устраняет необходимость вручную устанавливать смещение лампы. Во-вторых, компания BAT называет свою технологию «конструкции без предохранителей», в которой схемы тепловой и электронной защиты заменяют все, кроме предохранителя главного выключателя, требуемого правилами.

Тепловая защита, по словам основателя и главного инженера БАТ Виктора Хоменко, устраняет возможность «перенапряжения» агрегата. «Поскольку наши усилители не ограничиваются очевидным, неприятным образом… люди иногда загоняют их в свою красную зону, не осознавая этого. Теплозащита защищает от этого. Между тем, ток выходной трубки постоянно контролируется, и канал отключается выше установленного предела. Хоменко считает, что эта схема защиты, хотя и не требует замены перегоревших предохранителей, также является «звукопрозрачной».

Простота секции предусилителя VK-80i отражена на его передней панели. Небольшое окно дисплея обозначает вход и громкость, первое по номеру (здесь нет возможности переименовывать источники), а рядом с ним находятся маленькие кнопки для выбора входа, а также регулятор громкости усилителя. Поставляемый цельнометаллический телефон также невелик по функциональности, но поэтому с ним легко справиться. Используйте его для выбора источника, громкости, отключения звука и фейдера, а также для регулировки яркости дисплея усилителя.

Почувствуй тепло
Как только его лампы светятся, VK-80i устраивает настоящее шоу, но мне потребовалось некоторое время, чтобы в полной мере оценить его таланты. Это не усилитель с очевидным, преднамеренным тоном или голосом. Как и в случае с более ранним гибридным усилителем VK-3500 стоимостью 11 995 фунтов стерлингов [ HFN , сентябрь 21 г.], здесь нет ощущения искусственной теплоты. Нет и экстравагантного баса. Вместо этого VK-80i посыпает вас деталями, часто настолько тонкими, что поначалу вы этого не осознаете. Он четкий и откровенный, не крича об этом, сверхгладкий, когда это необходимо, цепкий и контролируемый, когда дело доходит до драки. Это волнующее прослушивание, хотя и не монстр-усилитель, поэтому партнерские колонки следует выбирать с осторожностью.

Balanced Audio Technology VK-655SE – Обзоры

Единственное обещание, которое BAT VK-655SE не выполняет, – это заявление компании о том, что у него достаточно энергии, чтобы «поднять большинство динамиков на высоту более одного метра над землей». Даже на оглушительном уровне ни колонки GamuT S9 весом 610 фунтов, ни колонки Dynaudio Evidence Platinum весом 253 фунта не отрываются от земли.

Что действительно обеспечивает VK-655SE, так это музыкальную точность, изысканную тональность и контроль басов. Обладая доступной мощностью 1800 Дж, VK-655SE стоимостью 16 500 долларов управляет нижней половиной частотного спектра так, как немногие усилители могут похвастаться любой ценой. Для зрителей, не являющихся инженерами-электриками, сердечный дефибриллятор потребляет от 200 до 400 джоулей на частоте 9 секунд.0272 максимальное значение , поэтому, хотя VK-655SE не поднимет ваши динамики над землей, если вы подсоедините кабели динамиков к груди и повернете их вверх, он, вероятно, поднимет вас на метр от земли. Возможно, они это имели в виду.

Говоря о весе, VK-655SE весит 120 фунтов, поэтому убедитесь, что ваша спина и любая подставка, на которую вы планируете поставить его, могут выдержать такой вес. Открыв крышку, вы обнаружите пару чудовищных радиаторов, силовых трансформаторов и конденсаторных батарей. VK-655 доступен полностью в черном цвете (как показано здесь) или с черно-серебристой алюминиевой лицевой панелью. В будущем BAT также будет предлагать только серебро, так что, если вы хотите эстетики, она уже в пути. Полностью предназначенный для использования в системе all-BAT, VK-655SE предлагает только симметричные входы XLR, хотя мы обнаружили, что VK-655SE одинаково хорошо работает с предусилителями Pass, ARC, Nagra, Simaudio и Robert Koda; все они использовались в полностью сбалансированной конфигурации.

Let’s Roll

VK-655SE особенный прямо из упаковочной коробки. Следуя кредо хот-роддеров: «Если вы хотите, чтобы он работал жестко, вы должны сильно разбить его», я немедленно беру альбом Metallica Kill ‘Em All и играю «No Remorse» на уровне, близком к армагеддонскому. Даже во время короткого периода доведения Dynaudio до пиковых значений почти в 120 дБ, BAT совершенно не напрягается, а грубая мощь Metallica полностью передается. Хотя я не могу себе представить, что вам понадобится большая мощность, вы можете превратить VK-655SE в моноблочный усилитель и получить немного больше, перейдя от 600 Вт на канал при нагрузке 4 Ом до 700 Вт на канал. (VK-655SE выдает 300 Вт на канал при нагрузке 8 Ом в качестве стереоусилителя и 400 Вт в качестве моноблока.)

Тем, кто насмехается над идеей платить в два раза больше всего за дополнительные 100 Вт на канал, следует помнить, что более высокая точность означает получение контроля, а не просто увеличение громкости. Это связано с тем, что при этом удваивает выходной ток , давая моноблокам возможность более легко управлять сложными нагрузками. Наличие в два раза большей мощности на отводе заставит эти моно работать еще легче, чем при их работе в стерео конфигурации, что приведет к более широкому динамическому диапазону и еще более тихому фону — 6 дБ в соответствии с BAT. Я замечаю аналогичный эффект от одного Burmester 9.11 МК3 усилитель мощности к паре 911 моно. Это не тонко. Я рискну и предложу, что пара монофонических VK-655SE даст те же результаты.

Опыт работы с прошлыми продуктами BAT с апгрейдом Super Pak (разнообразие маслонаполненных конденсаторов компании, помогающих упростить накопление энергии) показал, что этим компонентам требуется некоторое время, чтобы зазвучать как можно лучше — от двух до 500 часов. Более высокий ток больших усилителей мощности делает процесс несколько более быстрым; предусилители, кажется, занимают больше времени.

Слегка резкий при первом включении, VK-655SE звучит более открыто, естественно и расслабленно в верхнем регистре примерно после 48 часов непрерывной игры, с легким сглаживанием по мере увеличения часов, но не столь резко, как изменение в первые пару дней. Для раздражительных аудиофилов в толпе, которые не верят в обкатку компонентов, я настоятельно рекомендую одолжить пару идентичных усилителей, проработав один в течение нескольких сотен часов, пока вы оставляете один в коробке на этот период времени, а затем сравните два. Существует безошибочная разница между усилителем с часами на часах и тем, что остался в коробке.

Джефф Пур из BAT подчеркивает, что они стремятся к «динамической линейности» в своих проектах. Большая часть этого достигается за счет устранения отрицательной обратной связи в сочетании с неограниченным нерегулируемым источником питания, что увеличивает коэффициент скачка, которым славятся усилители BAT. Это также одна из основных причин, по которой этот огромный усилитель демонстрирует ловкость гораздо меньшего усилителя. Пур напоминает мне, что «использование только двух каскадов усиления в VK-655SE устраняет эффекты связи между несколькими каскадами усиления, еще больше уменьшая степень размытия и ухудшения изображения, которые возникают при более сложной конструкции».

В то время как некоторые производители усилителей мощности заявляют о двойном монофоническом дизайне, компания BAT доводит это до крайности. Помимо отдельных силовых трансформаторов и блоков питания для каждого канала, в VK-655SE даже используются отдельные шнуры питания и розетки для каждого канала! Если у вас есть доступ к выделенным линиям питания, я предлагаю попробовать отдельные линии питания в отдельных цепях для каждого канала. Мое любопытство с VK-655SE удовлетворяется подключением каждого канала к отдельным 20-амперным цепям. Конечно, вы не требуется две линии питания для VK-655SE, но с двумя отдельными сетями, питающими огонь на оглушительном уровне, усилитель демонстрирует еще большую простоту. Примерно в 95% случаев вы никогда этого не заметите, но если вам это действительно нравится громко , используйте отдельные цепи переменного тока для питания каждой половины вашего VK-655SE.

Краткое сравнение

Если вы считаете, что все усилители имеют одинаковый звук, прекратите читать прямо сейчас. Хотя лучшие в мире полупроводниковые усилители начинают звучать скорее похоже, чем по-разному, различия в характере звучания все еще существуют. Непосредственное сравнение с несколькими нашими обычными усилителями показывает, что BAT превосходит их по скорости, динамике и весу басов. Усилители Burmester и Pass в нашей конюшне тонально чуть теплее, а большие монофонические Simaudio MOON 880M звучат так же естественно, как BAT, но обладают более бездонной мощностью, хотя и по более высокой цене, чем пара VK-655SE. Это почти как сравнивать Audi с BMW или Mercedes. все отлично, хотя они доставляют товары немного по-другому.

Ни один из имеющихся у нас динамиков не представляет серьезной нагрузки для мощного BAT. Прожорливые к току Magnepan и даже наши винтажные Acoustat 2+2, которые имеют рейтинг чувствительности всего 82 дБ и представляют собой не более чем гигантские конденсаторы, размещенные на клеммах динамиков, ничуть не снижают производительность усилителя. В то время как некоторые усилители могут зависеть от динамиков и время от времени испытывать трудности, VK-655SE без особых усилий с легкостью подключает любой динамик, который у нас есть под рукой.

Частично нейтральное качество звука VK-655SE можно объяснить использованием в нем всех N-канальных выходных транзисторов MOSFET. N-канальный МОП-транзистор имеет более высокую подвижность электронов, что делает усилители с ними более быстродействующими, чем усилители со смешанными устройствами. Беглые исследования N-канального МОП-транзистора показывают, что N-канальное устройство также имеет более широкий диапазон работы, где он действует как триодная лампа — еще одна замечательная вещь, которую нужно иметь в усилителе мощности. Если отбросить технари, этот усилитель блестяще преуспевает, особенно за 16 500 долларов.

Чем больше, тем больше!

Некоторые аргументы в кругах аудиофилов — о качестве первого ватта и о том, что из-за присущей им сложности усилители большей мощности не так чисты, как маломощные усилители по конструкции и, следовательно, звуку — не всегда верны. . Эти аргументы, безусловно, неверны в случае с этим усилителем. Хотя я слышал отличные примеры как маломощных, так и мощных усилителей, я все же предпочитаю легкость мощного усилителя, даже при низкой громкости. VK-655SE использует новый подход, не имеющий отрицательной обратной связи и всего два каскада усиления во всей схеме. Точно так же, как некоторые большие колонки исчезают в вашей комнате для прослушивания, как мини-монитор, VK-655SE обладает мощью большого усилителя 9.0272 и нюанс небольшой мощности усилителя.

Прослушивание акустических инструментов подчеркивает характер VK-655SE. Его огромные запасы мощности могут быть незаметны при менее требовательной игре, но в тот момент, когда барабанная палочка ударяет по тарелке или с силой дергают струну контрабаса, безграничные резервы этого усилителя обеспечивают динамическое качание, необходимое для того, чтобы убедить вашу слуховую систему. что, возможно, вы вообще не слушаете записанную музыку.

Это в равной степени справедливо и при воспроизведении вокалиста с широким диапазоном. Будь то ваша любимая опера или Принц, VK-655SE обеспечивает мгновенную доставку без стресса, связанного с меньшими усилителями, неспособными идти в ногу с ним — и эта способность слишком часто упускается из виду, когда вы прыгаете на подножку с низким энергопотреблением. Каким бы простым это ни казалось, большой, хорошо выполненный усилитель просто звучит крупнее и не имеет сдержанности, что еще больше способствует его общему нейтральному характеру.

Во время этого обзора не было ничего, с чем VK-655SE не мог бы справиться легко. Среди имеющихся в моем распоряжении эталонных динамиков — все с рейтингом чувствительности от 87 до 90 дБ — я не могу себе представить, что когда-либо потребуется больше мощности, чем выдает этот усилитель. Оборудование BAT известно своим фантастическим качеством сборки и отличной стоимостью на вторичном рынке, поэтому для усилителя такого размера и цены я также не могу себе представить, что когда-либо понадобится еще один, когда вы перейдете к VK-655SE. Если, конечно, вам не нужен второй.

BAT VK-655SE power amplifier

MSRP: $16,500

www.balanced.com

PERIPHERALS

Analog Source Проигрыватель проигрывателя AVID Acutus Reference SP     Тонарм TriPlanar     Картридж Lyra Atlas
Фонокорректор ARC REF Phono 2SE
Предусилители Роберт Кода K-10    ARC REF5 SE    Pass Labs Xs
Цифровой источник Стек dCS Pagaini     Simaudio MOON 650D
Кабель Кардас Прозрачный
Мощность Изотек Супер Титан

Обзор продукта

Обзор продукта — сбалансированный Audio Technology (BAT) Стереоусилитель мощности ВК-500 — август, 1998Джон Э. Джонсон-младший

Сбалансированная аудиотехнология ВК-500 Двухканальный усилитель мощности

250 Вт RMS на канал на 8 Ом, 450 Вт на канал на 4 Ом

THD < 1 % при полной мощности

Входное сопротивление: 100 кОм

Скорость нарастания: > 300 В/мкм сек

Выходное сопротивление: 0,2 Ом

Размер: 9 1/2″ В x 19″ Ш х 23″D

Вес: 105 фунтов

Рекомендованная производителем розничная цена

: 5000 долларов за базовую версию. Модель, или 5800 долларов США с дополнительным хранилищем блока питания (BAT-PAK)

 

Balanced Audio Technology Inc., Бетховен, 26 Драйв, Уилмингтон, Делавэр, 19807; Телефон 302-999-8855 ; Факс 302-999-8818; Электронная почта [электронная почта защищена]; Интернет http://www. balanced.com.

Введение

Я знаю, я знаю, это большие деньги для усилитель, но после обзора феноменального балансного Ламповый предусилитель Audio VK-5i, мне просто нужно было посмотреть, Твердотельный усилитель мощности был так же хорош. Итак, я запросил ВК-500 Стереоусилитель мощности (ВК — конструктор Виктор Хоменко). Упомянув так много раз, что блок питания имеет решающее значение к характеристикам усилителя я попросил «БАТ-ПАК», что доводит общий запас энергии до 1100 Дж (350 Дж это стандартная поставка, которой еще совсем немного). БАТ сказал мне известно, что большинство их ВК-500 продаются с БАТ-ПАК. ВК-500 это двойной монофонический дизайн, что означает, что у него есть отдельные шнуры питания, тороидальные трансформаторы, конденсаторы питания и силовые цепи. Двойное моно обозначение то же, что и моноблоки, за исключением что у двойного монофонического усилителя все в одном корпусе вместо этого из двух отдельных шасси. Для блока питания 550 Дж. назначается каждому каналу с помощью BAT-PAK. На передней панели есть два переключателя включения/выключения (по одному на каждый канал) и два синих светодиода для индикация включения. На задней панели есть два симметричных входа XLR. гнезда, две пары позолоченных прочных пятиполосных динамиков стойки и съемные заземленные входные разъемы переменного тока. Радиаторы расширяются с обеих сторон шасси. Большая ручка сзади позволяет поднимая этот очень тяжелый усилитель как чемодан.

Цепи

В соответствии с современными тенденциями VK-500 использует тороидальные трансформаторы, а не трансформаторы с сердечником EI. Тороиды того же размера обладают большей мощностью, чем трансформаторы с сердечником EI, но дороже. Тороиды в ВК-500 имеют магнитное экранирование. и закрыты алюминиевыми банками. Накрытие трансформатора замедляет рассеивание тепла, но магнитное экранирование уменьшит взаимодействие магнитного поля трансформатора с близлежащими цепями. В ВК-500 используется множество небольших конденсаторов. а не несколько крупных. Это уменьшает последовательную индуктивность, и в любое время вы можете уменьшить реактивное сопротивление, которое вам не нужно в цепи, ухудшение сигнала также уменьшается. Схема платы красиво разложены внутри шасси, с каждой плата по существу является зеркальным отражением другой.

Большинство усилителей имеют от трех до пяти каскады усиления (усиления). Скажем, усилитель имеет пять. Три из них обычно являются частью раздела ввода, один будет каскадом драйвера (буфера) между секцией ввода и секция вывода, а пятая ступень будет секцией вывода. Входной каскад(ы) используется для усиления напряжения, буфер сценические интерфейсы между секцией ввода и секцией вывода, а выходной каскад предназначен для усиления тока.

VK-500 имеет только два каскада усиления, один входной каскад и выходной каскад. Входной каскад служит драйвер выходного каскада. В результате входной каскад имеет работать при очень высоком смещении, что означает большой ток, и, следовательно, высокая температура. Действительно, усилитель сильно нагревается во время использования, будь то на холостом ходу или на высокой мощности. Итак, прежде чем вы даже доберетесь до вывода, к источнику питания предъявляются значительные требования, т. одна из причин, почему на ВК-500 такой большой запас, даже с базовой моделью (та, что без БАТ-ПАК). Теперь большинство производители могли построить усилитель только с двумя каскадами, но это сложно и дорого, потому что часть процедуры означает имея огромный блок питания, а блок питания самый дорогой часть усилителя. Как потребители, большинство из нас не готов заплатить 5000 долларов за стереоусилитель. Но компания BAT выбрала сделать свои разработки бескомпромиссными продуктами, а из очевидных успеха, которого они добились, похоже, это был хороший путь к брать. Их идея состоит в том, что всего с двумя каскадами усиления можно меньше интерфейсов (каждый этап должен проходить через интерфейс для следующий), и, следовательно, происходит меньшее ухудшение сигнала. Запомнить, один усилитель не может «улучшить» звук по сравнению с еще один. Скорее один усилитель будет просто деградировать исходный сигнал меньше , чем другой.

Твердотельные усилители обычно тянуть с выходными устройствами типа P для одной стороны сигнала и Устройства типа N для другого (+ и — части сигнала). Подсчитав, что тип N быстрее из двух, BAT имеет использовались только МОП-транзисторы типа N (24 МОП-транзистора на канал) для обоих сторон сигнала. Это непростая задача, и на нее ушли годы инженерной мысли, но вознаграждение — очень быстрый усилитель (скорость нарастания 300 В/мкс).

ВК-500 полностью сбалансирован, т.е. от входа к выходу сигнал никогда не соединяется с землей. В несбалансированных усилителях отрицательный проводник (обратный путь сигнала) также является землей. Шум может попасть на путь прохождения сигнала, а когда он проходит на динамики, повышает уровень шума, что снижает возможность воспроизводить музыку с низким уровнем детализации. Потому что шум по фазе на положительном и отрицательном проводниках, а сигнал перевернут (проводники 1 и 3 на схеме слева) с сбалансированный сигнал, шум исчезает, когда сигнал от проводники объединены в усилитель. Это улучшает уровень шума, дающий жизнь деталям низкого уровня. ВК-500 вроде Другие продукты BAT имеют только входные разъемы XLR, без несбалансированных RCA. домкраты. Если вы хотите использовать несбалансированный вход от предусилителя, BAT дополнительно поставляет адаптеры RCA-XLR (9 долларов США).0/пара).

Звук

Я протестировал VK-500 с нашим компакт-диском McCormack. систему, ламповый предусилитель VK-5i, Nordost Cables и несколько комплекты динамиков, в том числе Carver Mark IV Platinum (ленты), Osborn Eclipses (конусы) и Threshold ES-500 (электростатика). Это дало мне полный набор нагрузок для ВК-500.

Мне было особенно интересно увидеть как ВК-500 работал с электростатическими динамиками, так как он не имеет глобальной обратной связи и, как следствие, большую, чем типичная выходное сопротивление 0,2 Ом. Высокое выходное сопротивление может вызвать странные эффекты с реактивной нагрузкой, такие как электростатический оратор. Все динамики реактивные, но «реактивная нагрузка» относится к динамику, который имеет большую емкость или индуктивность, чем большинство ораторов. У меня ВК-500 уже несколько месяцев, во время который я позволил ему «вломиться».

В VK-500 столько мощности и четких деталей, трудно понять, с чего начать его описание. Потому что сбалансированной конструкции, была абсолютная гробовая тишина со всем включен, но музыка не играет, ухо упирается в один из ораторов. С несбалансированными конструкциями и такими длинными межсоединениями (30 футов) между предусилителем и усилителем мощности я обычно слышу жужжание, когда я прижимаю ухо к динамику. у меня тоже 30 ножной комплект балансных межблочных кабелей (Nordost). Предусилитель ВК-5и тоже полностью сбалансирован, так что комбинация получилась очень и очень тихий шум. ВК-500 прогнал электростатику без напряга, до высокого уровня звукового давления и с такими глубокими басами, что весь диапазон электростатических панели заметно мерцали. Все детали и прозрачность, которые электростатика на что способна с топовыми усилителями была там. Это был такой хороший матч, что я чуть не вызвал мирового судью.

The Carver Platinums пели как соловьи. Хотя они могут иметь некоторую компенсацию из-за диполярной природы их низкочастотных динамиков, в них было еще так много глубокого баса, что я мог увидеть жидкую поверхность в моем стакане с безалкогольным напитком. Когда я добавил мощный сабвуфер (Velodyne FSR-18 и Sunfire Signature) для система дает мне ответ < 20 Гц, органные токатты почти поднял меня с кресла.

Осборны, пожалуй, самые легкие грузы в нашей лаборатории погонять, и они отлично звучали с ВК-500. Эти напольные колонки имеют специальный басовый отклик, подобный сабвуферу, и VK-500 продемонстрировал эту возможность в лучшем виде. Еще раз, все детали присутствовали. Огромная, грубая, чистая сила — вот в чем секрет. И под низким уровнем детализации я имею в виду тонкие нюансы которые находятся на фоне музыки, независимо от громкости в нее играют. Незаметный уровень шума VK-500 приводит к тому, что каждый нюанс присутствует, что придает звуку более реализм, больше воздействия, больше волос на затылке поднятый.

Добавить комментарий

Ваш адрес email не будет опубликован.